Lời tựa
Nội dung chính Show
Phần 1, bắt đầu Chương 1, Vỏ Python và Cơ bản Chương 2, Chương trình Python đầu tiên của bạn Phần 2, Quản lý dữ liệu Jor Chương 3, Phân tích cột dữ liệu Tính (một phương sai và) độ lệch chuẩn từ danh sách các số Đọc nhiều tệp và trích xuất dữ liệu Đọc một chuỗi từ một cấu trúc Chương 7, Quản lý dữ liệu bảng Chương 8, Dữ liệu sắp xếp Chương 9, Kết hợp mẫu và khai thác văn bản Phần 3, Lập trình mô -đun Chương 10, chia một chương trình thành các chức năng Chương 11 Quản lý sự phức tạp với các lớp Chương 12, Debugging¶ Chương 13, Sử dụng các mô -đun bên ngoài, giao diện Python để R¶ Chương 14, Chương trình xây dựng đường ống Chapter 15, Writing Good
Programs¶ Phần 4, Trực quan hóa dữ liệu Chương 16, Tạo sơ đồ khoa học Chương 18, Thao tác hình ảnh Phần 6, Cookbook¶ Công thức 2, đảo ngược và ngẫu nhiên một chuỗi Công thức 3, tạo một chuỗi ngẫu nhiên với xác suất Bur Ghi chú và đoạn mã mã. Python 2. Cuốn sách đi kèm với các tập tin và trường hợp. Python 2. Từ CRC Press, 2014.
Phần 1, bắt đầu Chương 1, Vỏ Python và Cơ bản Cấu trúc dữ liệu
Booleans: >>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Từ điển: Bộ sưu tập không có thứ tự của các cặp giá trị khóa; Cả hai có thể là số hoặc chuỗi; được chỉ định với >>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Phao: Số có chữ số sau điểm Dicemal, Số nguyên: Số không có chữ số sau Điểm thập phân. Danh sách: Bộ sưu tập các đối tượng được đặt hàng có thể thay đổi; được chỉ định với >>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Bộ: Bộ sưu tập không theo thứ tự bất biến của các yếu tố độc đáo; được biểu thị bằng >>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chuỗi: Bộ sưu tập ký tự được đặt hàng bất biến; được chỉ định với dấu ngoặc kép >>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tuples: Bộ sưu tập các đối tượng được đặt hàng bất biến; được chỉ định với >>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chuyển đổi
Chuyển đổi dữ liệu hoặc ép buộc: -
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Dây
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Trích dẫn ba lần và một số báo giá đôi khá nhiều.
Truy cập ký tự và chuỗi con
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Chuỗi chức năng
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tạo danh sách
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Sửa đổi danh sách
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Chức năng làm việc của danh sách
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Bộ dữ liệu
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Truy cập dữ liệu trong từ điển
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Sửa đổi từ điển
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Không có
Không cho biết đối tượng hoặc một phần của nó là trống. Ví dụ: -
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Chương 2, Chương trình Python đầu tiên của bạn Sự khác biệt giữa các chức năng và phương pháp
Các chức năng là chung chung; Sử dụng chúng ở bất cứ đâu mà không bị ràng buộc. Ví dụ,
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
>>> len ( 'protein' )
7
>>> len ( '111' )
3
Các chức năng khác, được gọi là phương pháp, là cụ thể; Sử dụng chúng trên một loại dữ liệu nhất định. Ví dụ:
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Đếm sự xuất hiện của mỗi axit amin theo trình tự protein
đếm, phần tử, trong, chuỗi
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Tạo một chuỗi DNA ngẫu nhiên có độ dài 10
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Phần 2, Quản lý dữ liệu Jor Chương 3, Phân tích cột dữ liệu Đọc từ một tệp văn bản
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Sự khác biệt giữa insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Một ký tự = 1 byte. Đóng và mở lại tập tin để đọc lại. insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Đóng và mở lại tập tin để đọc lại. insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Viết tệp văn bản
Làm sạch tệp văn bản
dải
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Viết và sau đó đọc cùng một tệp import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Đọc một loạt các số từ tệp văn bản và in tóm tắt dữ liệu
dải, phần phụ, chiều dài, tối thiểu, tối đa, sắp xếp, định dạng, số nguyên, phao import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Một văn bản là chuỗi theo mặc định thậm chí nghĩ rằng tệp chứa các số; Chuyển đổi văn bản thành float. insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Định dạng dữ liệu
Định dạng, biến import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Và như thế. import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Ouput:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Viết danh sách các số vào tệp văn bản
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tính trung bình từ danh sách các số
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tính trung bình từ danh sách các số
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tham gia hoặc kết hợp một danh sách
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tính (một phương sai và) độ lệch chuẩn từ danh sách các số Chương 4, Hồ sơ dữ liệu phân tích cú pháp
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tìm các mục phổ biến cho hai danh sách
** Tìm nếu hai hoặc nhiều điều kiện được đáp ứng
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
boolean, người vận hành, và, hoặc, không
Các nhà khai thác Boolean Tình trạng Nghĩa A Thấp hơn b Một Thấp hơn hoặc bằng b A> b Một lớn hơn b A> = b Lớn hơn hoặc bằng b A == b Bằng b A! = B Khác với B A b idem A là b A là điều tương tự như B ‘Thing là một đối tượng A không phải là B A không giống như B A trong b A có mặt trong chuỗi B A không ở b
A không có mặt trong chuỗi B
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Tìm tất cả số nguyên tố dưới 30
Danh sách vs tuple vs set Rằng: Thay đổi, thay thế, sắp xếp lại, thêm các yếu tố. import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Ba có thể chứa các chữ số, chuỗi hoặc các đối tượng khác (nhúng).
Thêm về danh sách import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Create:import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Tạo một danh sách với một vòng lặp một dòng
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Vòng lặp, có điều kiện, có điều kiện, trên một dòng
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Viết tất cả các tiêu đề từ một tệp vào một tệp riêng biệt
Đọc tất cả các số AC từ độ lệch của tệp
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Output:
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
phân tích cú pháp, phân tích cú pháp, văn bản, tệp
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Đọc một tệp (GenBank_File) và chuyển đổi nó thành một tệp khác (output_file)
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Đọc nhiều tệp và trích xuất dữ liệu Chương 5, Dữ liệu tìm kiếm
Dịch chuỗi RNA sang chuỗi protein trong ba khung đọc
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
từ điển
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
Đầu ra (chứa một chuỗi dịch cho mỗi khung đọc):
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Output:
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Trong khi lặp lại
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Output:
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Tìm chuỗi A trong một tệp
Tìm kiếm một danh sách
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Output:
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Tìm kiếm
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Output:
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Đọc một tập tin và lưu trữ các mục trong từ điển
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Output:
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Đọc một chuỗi từ một cấu trúc Chương 6, Lọc dữ liệu Jor
Tính toán giao điểm của hai danh sách
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Output:
Venn
bộ
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Chúng không phải là đối tượng tuần tự như danh sách. Chúng không thể chứa các yếu tố giống hệt nhau.để loại bỏ các bản sao để tính toán giao điểm liên minh Sự khác biệt giữa hai hoặc nhiều nhóm đối tượng miễn là lệnh không quan trọng. Họ không hỗ trợ các hoạt động lập chỉ mục và cắt. Họ lấy các toán tử import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Tính toán giao điểm của hai bộ
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Output:
Tìm số phổ biến cho ba bộ
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Output:
Tính toán sự khác biệt của hai danh sách
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Output:
Tính toán sự khác biệt của hai bộ 1
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Output:
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Tính toán sự khác biệt của hai bộ 2
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Output:
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Xóa các yếu tố khỏi danh sách
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
delete
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
gỡ bỏ
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Cắt một danh sách
Cắt lát, tập hợp con
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Loại bỏ các yếu tố khỏi từ điển
Pop, xóa
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Xóa các dòng cụ thể khỏi tệp văn bản hoặc ghi lại các dòng cụ thể trong một tệp mới
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Xóa một số dòng khỏi tệp văn bản
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Xóa một số dòng khỏi tệp văn bản với import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
liệt kê
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Xóa các bản sao khỏi một tệp có số gia nhập 1
bộ
Sử dụng một bộ nhanh hơn nhưng biến dạng thứ tự.
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Xóa các bản sao khỏi danh sách các số gia nhập 2
danh sách
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
So sánh hai danh sách mã gia nhập bằng cách sử dụng các bộ
Đặt so sánh, khác biệt
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Chương 7, Quản lý dữ liệu bảng Dữ liệu gốc
chất đạm ext1 ext2 ext3 0.16 0.038 0.044 0.04 0.33 0.089 0.095 0.091 0.66 0.184 0.191 0.191 1.0 0.28 0.292 0.283 1.32 0.365 0.367 0.365 1.66 0.441 0.443 0.444
Đọc dữ liệu bảng từ tệp văn bản được phân tách bằng tab
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Output:
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Viết danh sách lồng vào tệp văn bản
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Định dạng lại một cột bốn cột đến hai cột
Tạo một bảng 2D.
In dòng bảng từng dòng.
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Output:
chất đạm Đọc dữ liệu bảng từ tệp văn bản được phân tách bằng tab 0.16 0.038 0.33 0.089 0.66 0.184 1.0 0.28 1.32 0.365 1.66 0.441 0.16 0.044 0.33 0.095 0.66 0.191 1.0 0.292 1.32 0.367 1.66 0.443 0.16 0.04 0.33 0.091 0.66 0.191 1.0 0.283 1.32 0.365 1.66 0.444
Viết danh sách lồng vào tệp văn bản
Định dạng lại một cột bốn cột đến hai cột
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
In dòng bảng từng dòng.
ext
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Tạo một bảng; Danh sách trong danh sách
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Trống 1.
ext
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
ext
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
Tạo một bảng; Danh sách trong danh sách Trống 1.
Trống 2.
Mã hóa danh sách 2D; Danh sách trong danh sách
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
Output:
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
bảng, bảng, hai chiều Mã hóa một danh sách các bộ dữ liệu lồng nhau; Tuples trong một danh sách Trích xuất, truy cập các hàng và ô từ bảng 2D
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
ext
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
Tạo một bảng; Danh sách trong danh sách
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
Mã hóa danh sách 2D; Danh sách trong danh sách
bảng, bảng, hai chiều
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
Mã hóa một danh sách các bộ dữ liệu lồng nhau; Tuples trong một danh sách Trích xuất, truy cập các hàng và ô từ bảng 2D import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
output_file = open ( 'counts.txt' )
output_file . read ()
output_file . close ()
# vs
output_file = open ( 'counts.txt' )
output_file . read () . strip ()
output_file . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Vòng lặp để truy cập từng hàng
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
Vòng lặp để truy cập từng ô
Trích xuất, các cột truy cập từ bảng 2D chuyển đổi cột sang hàng, hàng sang cộtCột trở thành hàng. Dễ dàng hơn để trích xuất hoặc chèn các hàng và ô. Nhưng các hàng bây giờ là những bộ dữ liệu bất biến! Bạn không thể thao túng các tế bào riêng lẻ. Danh sách và từ điển hỗn hợp:Sử dụng lợi thế của cả hai loại và xây dựng bảng cho phù hợp (L, D hoặc D, L cho các hàng, cột) tùy thuộc vào các hoạt động (xem ở trên). Mã khó đọc hơn hoặc ít đơn giản hơn. Chuyển đổi một bảng từ danh sách lồng nhau sang từ điển lồng nhau
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
Output:
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
… Và chuyển đổi một từ điển lồng nhau thành một bàn
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
Output:
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
Chương 8, Dữ liệu sắp xếp Sắp xếp một bảng theo một cột và ghi nó vào một tệp
Thêm, chỉ mục, danh sách
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
Đầu ra (chỉ 3 dòng đầu tiên):
file1 = open ( 'count.txt' , 'w' )
file1 . write ( 'this is just a dummy test \n ' )
file1 . close ()
file2 = open ( 'count.txt' , 'r' )
print file2 . read ()
file2 . close ()
file3 = open ( 'count.txt' , 'a' )
file3 . write ( 'this is another test \n ' )
file3 . close ()
file4 = open ( 'count.txt' , 'r' )
print file4 . read ()
file4 . close ()
file5 = open ( 'count.txt' , 'w' )
file5 . write ( 'this is a final test \n ' )
file5 . close ()
file6 = open ( 'count.txt' , 'r' )
print file6 . read ()
file6 . close ()
Danh sách rất tốt để sắp xếp
Biểu đồ thứ tự sắp xếp ASCII (từ trên xuống dưới, từ trái sang phải): không gian 0 : Một Q. [ một Q. } !! 1 ; B R \ b r Đánh dấu Phạm tội này 2 < C S ] c S { # 3 = D T ^ d t
$ 4 > E U _ e u Del Phần trăm 5 ? F V ` f v
Không có giá trị 6 @ G W
g w
Thì 7
H X
h x
. 8
Tôi Y
tôi y
) 9
J Z
j z
*
K
k
+
L
l
Thì
M
m
-
N
N
.
O
o
/
P
P
Sự khác biệt giữa import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Sắp xếp các mục trong một tệp đầu ra bảng theo thứ tự ngược lại
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Sắp xếp một tuple bằng cách chuyển đổi nó thành một danh sách
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Cả hai đầu ra:
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Chuyển đổi từ điển thành danh sách được sắp xếp
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Output:
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Sắp xếp dây theo chiều dài của chúng
lamda, chức năng
Sử dụng hàm import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Đầu ra giống nhau:
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Sắp xếp một bảng theo bảy cột trong một hoạt động
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Đầu ra (chỉ 3 dòng đầu tiên):
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Sắp xếp các mục trong tệp đầu ra vụ nổ theo bảng theo thứ tự ngược lại
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Sắp xếp các mục trong tệp phân tách bằng dấu phẩy theo hai cột
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chương 9, Kết hợp mẫu và khai thác văn bản Tìm một mẫu trình tự theo một chuỗi
Regex, biểu hiện chính quy
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
first occurence within the string.import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
all the matching substrings.import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
all the match objects corresponding to the regex matches and returns them in the form of an iterator.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Ouput:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Thêm các phương pháp import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Chia regex trong các nhóm nhỏ, mỗi nhóm phù hợp với một thành phần quan tâm khác nhau. import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
‘Bất kỳ ký tự nào cũng là một nhóm phụ. Những gì từng được tìm thấy giữa import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Vòng loại hoặc định lượng này có nghĩa là ít nhất 0 và nhiều nhất là 3 lần lặp lại của ‘r. import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Tìm nhiều mẫu trong chuỗi tìm kiếm
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
Một ví dụ khác với hai nhóm nhỏ
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
Gán tên cho phân nhóm: text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Ouput:
Thêm các phương pháp import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Chia regex trong các nhóm nhỏ, mỗi nhóm phù hợp với một thành phần quan tâm khác nhau. import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
‘Bất kỳ ký tự nào cũng là một nhóm phụ.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Những gì từng được tìm thấy giữa import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Vòng loại hoặc định lượng này có nghĩa là ít nhất 0 và nhiều nhất là 3 lần lặp lại của ‘r.
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
Tìm nhiều mẫu trong chuỗi tìm kiếm Một ví dụ khác với hai nhóm nhỏ text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Gán tên cho phân nhóm: text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Nó có thể dừng lại trong lần xuất hiện đầu tiên.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Thêm các phương pháp import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
import random
alphabet = "AGCT"
sequence = ""
for i in range ( 10 ):
index = random . randint ( 0 , 3 )
sequence = sequence + alphabet [ index ]
print sequence
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Python regex, nhân vật và metacharaters
Phần 3, Lập trình mô -đun Chương 10, chia một chương trình thành các chức năng Chức năng tích hợp sẵn
Chiều dài, tổng, tổng, phạm vi
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Xác định chức năng
DocString, DocStrings
Tài liệu được truy xuất với thuộc tính text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chức năng Lambda
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
vs
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
hoặc
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Output:
data = []
for line in open ( 'neuron_data.txt' ):
length = float ( line . strip ())
data . append ( length )
n_items = len ( data )
total = sum ( data )
shortest = min ( data )
longest = max ( data )
data . sort ()
output = open ( "results.txt" , "w" )
output . write ( "number of dendritic lengths : %4i \n " % ( n_items ))
output . write ( "total dendritic length : %6.1f \n " % ( total ))
output . write ( "shortest dendritic length : %7.2f \n " % ( shortest ))
output . write ( "longest dendritic length : %7.2f \n " % ( longest ))
output . write ( " %37.2f \n %37.2f " % ( data [ - 2 ], data [ - 3 ]))
output . close ()
Đối số chức năng
lập luận bắt buộc. từ khóa đối số. Đối số mặc định. Đối số có độ dài thay đổi. 1. Đối số cần thiết
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
2. Đối số từ khóa
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
3. Đối số mặc định
sự phối hợp
Đối số được đưa ra theo mặc định; Nhưng có thể được ghi đè!
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
4. Đối số có độ dài thay đổi
Đối số, danh sách, tuple, từ điển
Tính linh hoạt của việc cung cấp bất kỳ tuple.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Cung cấp cả các khóa và giá trị cho một từ điển được trả về.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chuyển đổi một chuỗi thành một tuple hoặc ngược lại
Gói text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Trong định dạng, text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Sau đó, chuyển đổi tuple thành một danh sách nếu cần. Chức năng tính khoảng cách giữa hai tọa độ
sức mạnh
Gói text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Gói text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Đầu ra:
Chương 11 Quản lý sự phức tạp với các lớp Các lớp học
Xác định một lớp: text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Thêm Docstrings. Constructor text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Một lớp có thể có nhiều trường hợp. text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Tạo một chức năng lớp; Một chức năng lớp hoạt động giống như một phương thức.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
In một đối tượng được tạo từ một lớp
In một đối tượng từ một lớp không phải là nhiều thông tin.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Đầu ra mới:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Không có sự khác biệt giữa
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Đối tượng Các thuộc tính lớp được xác định trước:
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Một tập lệnh Python có thể được nhập giống như một gói:
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Từ đồng nghĩa: Gói, thư viện, mô -đun, tập lệnh, v.v.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Output:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Nhiều thuộc tính hơn:text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Chương 12, Debugging¶ sâu bọ
Các loại lỗi:Lỗi logic. Lỗi cú pháp. Lỗi thời gian chạy. IDE (Eric, Pycharm, v.v.) Tự động gỡ lỗi.
1. Lỗi hợp lý (ngữ nghĩa)
Kết quả là sai vì chương trình làm một cái gì đó khác với những gì bạn có trong đầu. 2. Lỗi cú pháp
Biểu tượng sai lầm, sai lầm, vị trí sai trong mã, v.v.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Lỗi 1
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Lỗi 2
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
3. Lỗi thời gian chạy
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Nguyên nhân: text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Khắc phục: Thêm dòng text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Các lỗi và nguyên nhân phổ biến khác:Tên đối tượng không xác định:một tên không được nhập (text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Một tên không được khởi tạo (như trong text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Nguyên nhân và sửa chữa: Khi text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Nguyên nhân và sửa chữa: chìa khóa không tồn tại! text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Nguyên nhân và sửa chữa: Khi một đối tượng được tải với một loại sai để thực hiện một thao tác khác; Biến text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Các lỗi và nguyên nhân phổ biến khác: text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Nguyên nhân và sửa chữa: Một đối tượng không hỗ trợ gán mục.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Nguyên nhân: Không thể chuyển đổi ngầm một đối tượng.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Nguyên nhân: Một đối tượng bị hiểu sai (đối với một đối tượng khác).
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Nguyên nhân và sửa chữa: Áp dụng đúng phương pháp.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Nguyên nhân và sửa chữa: Một biến được tham chiếu trước khi gán. Biện pháp đối phó để ngăn ngừa lỗi
Phá vỡ mã trong các phần; In vào một tệp bằng cách sử dụng text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
So sánh đầu vào và đầu ra (in dữ liệu đầu vào, in dữ liệu đầu ra, tạo các điểm điều khiển). Thêm rất nhiều câu lệnh text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Sử dụng tên đối tượng mô tả và rõ ràng (text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Chức năng bắt đầu với các động từ (text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Thêm ý kiến. Tránh text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Theo PEP8 và PEP20! text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
IDE (Eric, Pycharm, Spyder, v.v.) Tự động gỡ lỗi và dễ dàng thực hiện text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Một ghi chú trên text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Python2, Python3, Py2, PY3
Trong Python 2, text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Hàm text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Trong Python 3, text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Biện pháp đối phó để ngăn ngừa lỗi: Trình gỡ lỗi Python hoặc text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Mã được thực thi theo từng dòng:N N N -thực hiện dòng tiếp theo. ‘S thực thi dòng tiếp theo nhưng không đi vào các chức năng. ‘Lát cho thấy nơi trong mã hiện tại. ‘C, tiếp tục thực hiện bình thường. Countermeasurea để ngăn ngừa lỗi: text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Thông thường, ngoại lệ là lỗi chính tả và các mục sai:text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
Hiếm khi chúng ta sẽ thấy:text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' , 'r' )
# 'r' is facultative
lines = text_file . readlines ()
text_file . close ()
print lines
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Chương 13, Sử dụng các mô -đun bên ngoài, giao diện Python để R¶ Mã r:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Mã Python:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tính giá trị trung bình từ tệp bảng
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Vẽ một biểu đồ
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tính toán điểm Z và giá trị P
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tạo một biểu đồ tương tác và biểu đồ từ dữ liệu trong một tệp
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tạo một lô tương tác
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Tiến hành kiểm tra chi bình phương trên dữ liệu từ tệp văn bản
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chương 14, Chương trình xây dựng đường ống Các chương trình có thể làm việc cùng với Python
Tham khảo: Phụ lục D.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Command lines in Python
UNIX to Python:UNIX text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
UNIX text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
UNIX text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
UNIX text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
UNIX text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
and many more. Pipelines
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Attributes
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Working with files and directories
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Export the path
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Read files from directories
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Chapter 15, Writing Good
Programs¶ Priorities
Make it work. Make it nice. Make if fast. Tips
Divide a programming project into smaller tasks. What are the inputs? What are the outputs? What is between them? Write smaller programs;
split a program into functions and classes. Analyze and run tests. Adopt PEP. Scaffold before writing a functional program:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Adopt PEP
Enforce PEP
Version controls
Use version control programs (Mercurial, git, SVN). Use repository (GitHub, Bitbucket) to control program versions.GitHub Bitbucket SourceForce Gitlab and
others. Before releasing (to a repository)
Create a directory with a concise name containing all the project. Set a version number (0.1 or 1.0). Write a README.TXT file with the name of the program, the author, contacts, numbers, emails, a version number, the program purpose in 50-100 words, how to use the program, simple command-line examples, the license (“All rights reserved”, MIT, etc.) Create a zip file out of the
directory including the README.TXT file in addition to the unzipped directory. Release the project on a repository (for example, with git, push the project to the repository). Releasing a distribution
Release a distribution to a repository for others to download and install. Freezing a program
Non-programmer would rather want an execuble program they can unzip and run. Compile the code or freeze
it!
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Cython là một ngôn ngữ được biên dịch tạo ra các mô -đun mở rộng CPYThon. Jython cũng làm như vậy, nhưng trong Java. Cải tiến liên tục
Một chương trình tốt không bao giờ kết thúc:Tạo một bản phát hành cơ bản. Cập nhật và phát hành các phiên bản mới. Nói với người dùng những gì mới. Nghe người dùng, cải thiện nó. Tiếp tục lập trình. Phát triển phần mềm
Tuyên ngôn Agile. Phương pháp: Scrum, lập trình cực đoan, v.v. Phần 4, Trực quan hóa dữ liệu Chương 16, Tạo sơ đồ khoa học Gói text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Gói text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Mẹo: Cài đặt toàn bộ ngăn xếp Scipy: (Python (2.x> = 2.6 hoặc 3.x> = 3.2), Numpy (> = 1.6), Thư viện SCIPY (> = 0.10), matplotlib (> = 1.1) với DateUtil và pytz, ipython (> = 0,13) với pyzmq và lốc xoáy, gấu trúc (> = 0,8), sympy (> = 0,7), mũi (> = 1.1). text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
Vẽ một lô đơn giản
Cung cấp text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Vẽ một hàm sin
Tạo text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Vẽ một biểu đồ
Cung cấp các điểm text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Thêm một tiêu đề, nhãn, trục và đường lưới.
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Vẽ một lô thanh
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Thêm một tiêu đề, nhãn, trục và đánh dấu vào các trục, và một huyền thoại. output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Thêm các thanh lỗi vào biểu đồ phân tán hoặc biểu đồ thanh
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Vẽ biểu đồ hình tròn với các lát nhô ra
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Chương 18, Thao tác hình ảnh Mẹo: Cài đặt toàn bộ ngăn xếp Scipy: (Python (2.x> = 2.6 hoặc 3.x> = 3.2), Numpy (> = 1.6), Thư viện SCIPY (> = 0.10), matplotlib (> = 1.1) với DateUtil và pytz, ipython (> = 0,13) với pyzmq và lốc xoáy, gấu trúc (> = 0,8), sympy (> = 0,7), mũi (> = 1.1).
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Vẽ một lô đơn giản
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Cung cấp text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Vẽ một hàm sin Tạo text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Vẽ một biểu đồ
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Cung cấp các điểm text_file = open ( 'neuron_data.txt' )
# 'r' is facultative
print text_file . read ()
text_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Thêm một tiêu đề, nhãn, trục và đường lưới. Vẽ một lô thanh output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Thêm một tiêu đề, nhãn, trục và đánh dấu vào các trục, và một huyền thoại. output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
insulin = "GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT"
for amino_acid in "ACDEFGHIKLMNPQRSTVWY" :
number = insulin . count ( amino_acid )
print amino_acid , number
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Thêm các thanh lỗi vào biểu đồ phân tán hoặc biểu đồ thanh Có thể sử dụng các ký hiệu toán học, chỉ số và siêu ký tự trong chuỗi:output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Vẽ một vòng cung: Vẽ một đa giác: Vẽ đường thẳng:output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
output_file = open ( 'counts.txt' , 'w' )
# 'w' is mandatory
output_file . write ( 'number of neuron lengths: 7 \n ' )
output_file . close ()
Xoay hình ảnh: Thêm văn bản: Vẽ hình ảnh của một plasmid và dán nhãn nó
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Result:
Phần 6, Cookbook¶ Công thức 2, đảo ngược và ngẫu nhiên một chuỗi Sắp xếp, đảo ngược, ngẫu nhiên, xác suất, danh sách, vòng lặp
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Ouput:
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
Công thức 3, tạo một chuỗi ngẫu nhiên với xác suất Bur ngẫu nhiên, danh sách, tạo, xác suất
>>> 'protein' . count ( 'r' )
1
>>> 'occurence' . count ( 'c' )
3
